Lineage for d1jckb1 (1jck B:1-121)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059133Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2059134Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2059163Domain d1jckb1: 1jck B:1-121 [25196]
    Other proteins in same PDB: d1jcka1, d1jcka2, d1jckb2, d1jckc1, d1jckc2, d1jckd2

Details for d1jckb1

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen
PDB Compounds: (B:) staphylococcal enterotoxin c3

SCOPe Domain Sequences for d1jckb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckb1 b.40.2.2 (B:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
n

SCOPe Domain Coordinates for d1jckb1:

Click to download the PDB-style file with coordinates for d1jckb1.
(The format of our PDB-style files is described here.)

Timeline for d1jckb1: