Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Lactobacillus plantarum [TaxId:644042] [256255] (3 PDB entries) |
Domain d4feeb2: 4fee B:183-365 [251955] Other proteins in same PDB: d4feea1, d4feea3, d4feeb1, d4feeb3 automated match to d1powa1 complexed with fad, gol, mg, po4, pyr, tdm |
PDB Entry: 4fee (more details), 1.13 Å
SCOPe Domain Sequences for d4feeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4feeb2 c.31.1.0 (B:183-365) automated matches {Lactobacillus plantarum [TaxId: 644042]} yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas led
Timeline for d4feeb2: