Lineage for d1sebh1 (1seb H:2-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398594Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2398595Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2398619Domain d1sebh1: 1seb H:2-121 [25195]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh2

Details for d1sebh1

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (H:) enterotoxin type b

SCOPe Domain Sequences for d1sebh1:

Sequence, based on SEQRES records: (download)

>d1sebh1 b.40.2.2 (H:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d1sebh1 b.40.2.2 (H:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtydnvr
vefknkdladkykdkyvdvfganyyyqcyfskkktcmyggvteh

SCOPe Domain Coordinates for d1sebh1:

Click to download the PDB-style file with coordinates for d1sebh1.
(The format of our PDB-style files is described here.)

Timeline for d1sebh1: