SCOPe 2.06: Domain d4fasb_: 4fas B:

Lineage for d4fasb_ (4fas B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (11 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:228410] [256253] (1 PDB entry)

8. Domain d4fasb_: 4fas B: [251946]
   automated match to d1fgja_
   complexed with edo, hec, isw, no3, p6g, peg, pg4, pge

Details for d4fasb_

PDB Entry: 4fas, 2.1 Å

PDB Description: complex crystal structure of hydroxylamine oxidoreductase and ne1300 from nitrosomonas europaea

PDB Compounds: (B:) hydroxylamine oxidoreductase

SCOPe Domain Sequences for d4fasb_:

Sequence; same for both SEQRES and ATOM records:

>d4fasb_ a.138.1.3 (B:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
iqdeytkmqelsalqarvnkle

Timeline for d4fasb_:

• d4fasb_ first appeared in SCOPe 2.04
  
• d4fasb_ appears in SCOPe 2.05
  
• d4fasb_ appears in SCOPe 2.07
  
• d4fasb_ appears in the current release, SCOPe 2.08