Lineage for d4fasb_ (4fas B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734414Protein automated matches [190276] (12 species)
    not a true protein
  7. 2734454Species Nitrosomonas europaea [TaxId:228410] [256253] (1 PDB entry)
  8. 2734456Domain d4fasb_: 4fas B: [251946]
    automated match to d1fgja_
    complexed with edo, hec, isw, no3, p6g, peg, pg4, pge

Details for d4fasb_

PDB Entry: 4fas (more details), 2.1 Å

PDB Description: complex crystal structure of hydroxylamine oxidoreductase and ne1300 from nitrosomonas europaea
PDB Compounds: (B:) hydroxylamine oxidoreductase

SCOPe Domain Sequences for d4fasb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fasb_ a.138.1.3 (B:) automated matches {Nitrosomonas europaea [TaxId: 228410]}
distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
aereserdtmvwpngqwpagrpshaldytaniettvwaampqrevaegctmchtnqnkcd
nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
fgiftqlfwskgnnpaslelkvlemaennlakmhvglahvnpggwtytegwgpmnrayve
iqdeytkmqelsalqarvnkle

SCOPe Domain Coordinates for d4fasb_:

Click to download the PDB-style file with coordinates for d4fasb_.
(The format of our PDB-style files is described here.)

Timeline for d4fasb_: