Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.3: Hexokinase [53083] (3 proteins) |
Protein Mammalian type I hexokinase [53086] (2 species) further duplication: consists of two very similar lobes |
Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries) |
Domain d4f9ob1: 4f9o B:16-222 [251941] automated match to d1czan1 complexed with 0nz, bgc, cit, na |
PDB Entry: 4f9o (more details), 2.65 Å
SCOPe Domain Sequences for d4f9ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f9ob1 c.55.1.3 (B:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk rgdydanivavvndtvgtmmtcgyddq
Timeline for d4f9ob1:
View in 3D Domains from other chains: (mouse over for more information) d4f9oa1, d4f9oa2, d4f9oa3, d4f9oa4 |