SCOPe 2.05: Domain d4f9ob1: 4f9o B:16-222

Lineage for d4f9ob1 (4f9o B:16-222)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Mammalian type I hexokinase [53086] (2 species)
   further duplication: consists of two very similar lobes

7. Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)

8. Domain d4f9ob1: 4f9o B:16-222 [251941]
   automated match to d1czan1
   complexed with 0nz, bgc, cit, na

Details for d4f9ob1

PDB Entry: 4f9o, 2.65 Å

PDB Description: crystal structure of recombinant human hexokinase type i with 2-deoxy- glucose 6-phosphate

PDB Compounds: (B:) Hexokinase-1

SCOPe Domain Sequences for d4f9ob1:

Sequence; same for both SEQRES and ATOM records:

>d4f9ob1 c.55.1.3 (B:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
rgdydanivavvndtvgtmmtcgyddq

Timeline for d4f9ob1:

• d4f9ob1 first appeared in SCOPe 2.04
  
• d4f9ob1 appears in SCOPe 2.06
  
• d4f9ob1 appears in the current release, SCOPe 2.08