SCOPe 2.07: Domain d4f9kc_: 4f9k C:

Lineage for d4f9kc_ (4f9k C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.0: automated matches [254326] (1 protein)
   not a true family

6. Protein automated matches [254747] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256252] (1 PDB entry)

8. Domain d4f9kc_: 4f9k C: [251931]
   automated match to d3im3a_

Details for d4f9kc_

PDB Entry: 4f9k, 2.8 Å

PDB Description: crystal structure of human camp-dependent protein kinase type i-beta regulatory subunit (fragment 11-73), northeast structural genomics consortium (nesg) target hr8613a

PDB Compounds: (C:) cAMP-dependent protein kinase type I-beta regulatory subunit

SCOPe Domain Sequences for d4f9kc_:

Sequence; same for both SEQRES and ATOM records:

>d4f9kc_ a.31.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqksns

Timeline for d4f9kc_:

• d4f9kc_ first appeared in SCOPe 2.04
  
• d4f9kc_ appears in SCOPe 2.06
  
• d4f9kc_ appears in the current release, SCOPe 2.08