Lineage for d4f9kc_ (4f9k C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322371Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 2322372Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 2322423Family a.31.1.0: automated matches [254326] (1 protein)
    not a true family
  6. 2322424Protein automated matches [254747] (1 species)
    not a true protein
  7. 2322425Species Human (Homo sapiens) [TaxId:9606] [256252] (1 PDB entry)
  8. 2322428Domain d4f9kc_: 4f9k C: [251931]
    automated match to d3im3a_

Details for d4f9kc_

PDB Entry: 4f9k (more details), 2.8 Å

PDB Description: crystal structure of human camp-dependent protein kinase type i-beta regulatory subunit (fragment 11-73), northeast structural genomics consortium (nesg) target hr8613a
PDB Compounds: (C:) cAMP-dependent protein kinase type I-beta regulatory subunit

SCOPe Domain Sequences for d4f9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f9kc_ a.31.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgcelyvqlhgiqqvlkdcivhlciskperpmkflrehfeklekeenrqilarqksns

SCOPe Domain Coordinates for d4f9kc_:

Click to download the PDB-style file with coordinates for d4f9kc_.
(The format of our PDB-style files is described here.)

Timeline for d4f9kc_: