SCOPe 2.07: Domain d4f83a1: 4f83 A:867-1071

Lineage for d4f83a1 (4f83 A:867-1071)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)

8. Domain d4f83a1: 4f83 A:867-1071 [251924]
   Other proteins in same PDB: d4f83a2, d4f83a3
   automated match to d3pmea1
   complexed with gol, pg4, so4

Details for d4f83a1

PDB Entry: 4f83, 1.7 Å

PDB Description: Crystal structure of the receptor binding domain of botulinum neurotoxin mosaic serotype C/D with a tetraethylene glycol molecule bound on the Hcn sub-domain and a sulfate ion at the putative active site

PDB Compounds: (A:) Type C neurotoxin

SCOPe Domain Sequences for d4f83a1:

Sequence, based on SEQRES records:

>d4f83a1 b.29.1.0 (A:867-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
lysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrky
kslifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktiv
fgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records):

>d4f83a1 b.29.1.0 (A:867-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
lyyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrkyksl
ifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktivfgi
denidenqmlwirdfnifskel

Timeline for d4f83a1:

• d4f83a1 first appeared in SCOPe 2.04
  
• d4f83a1 appears in SCOPe 2.06
  
• d4f83a1 appears in the current release, SCOPe 2.08