Lineage for d4f83a1 (4f83 A:867-1071)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781886Species Clostridium botulinum [TaxId:1491] [225675] (21 PDB entries)
  8. 1781889Domain d4f83a1: 4f83 A:867-1071 [251924]
    Other proteins in same PDB: d4f83a2
    automated match to d3pmea1
    complexed with gol, pg4, so4

Details for d4f83a1

PDB Entry: 4f83 (more details), 1.7 Å

PDB Description: Crystal structure of the receptor binding domain of botulinum neurotoxin mosaic serotype C/D with a tetraethylene glycol molecule bound on the Hcn sub-domain and a sulfate ion at the putative active site
PDB Compounds: (A:) Type C neurotoxin

SCOPe Domain Sequences for d4f83a1:

Sequence, based on SEQRES records: (download)

>d4f83a1 b.29.1.0 (A:867-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
lysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrky
kslifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktiv
fgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records): (download)

>d4f83a1 b.29.1.0 (A:867-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
lyyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrkyksl
ifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktivfgi
denidenqmlwirdfnifskel

SCOPe Domain Coordinates for d4f83a1:

Click to download the PDB-style file with coordinates for d4f83a1.
(The format of our PDB-style files is described here.)

Timeline for d4f83a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f83a2