SCOPe 2.01: Domain d2sebd1: 2seb D:2-121

Lineage for d2sebd1 (2seb D:2-121)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (12 PDB entries)

8. Domain d2sebd1: 2seb D:2-121 [25192]
   Other proteins in same PDB: d2seba1, d2seba2, d2sebb1, d2sebb2, d2sebd2
   complexed with nag

Details for d2sebd1

PDB Entry: 2seb, 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

PDB Compounds: (D:) enterotoxin type b

SCOPe Domain Sequences for d2sebd1:

Sequence, based on SEQRES records:

>d2sebd1 b.40.2.2 (D:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records):

>d2sebd1 b.40.2.2 (D:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikydnvrve
fknkdladkykdkyvdvfganyyyqcyfskrktcmyggvteh

Timeline for d2sebd1:

• d2sebd1 first appeared (with stable ids) in SCOP 1.55
  
• d2sebd1 appears in SCOP 1.75
  
• d2sebd1 appears in SCOPe 2.02
  
• d2sebd1 appears in the current release, SCOPe 2.08