Lineage for d4f5va3 (4f5v A:389-584)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343957Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (5 PDB entries)
  8. 2343963Domain d4f5va3: 4f5v A:389-584 [251899]
    automated match to d4emxa3
    complexed with act, pg4, pge

Details for d4f5va3

PDB Entry: 4f5v (more details), 2.27 Å

PDB Description: Crystal Structure of Leporine Serum Albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4f5va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5va3 a.126.1.0 (A:389-584) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
kqncelyeqlgdynfqnallvrytkkvpqvstptlveisrslgkvgskcckhpeaerlpc
vedylsvvlnrlcvlhektpvsekvtkccseslvdrrpcfsalgpdetyvpkefnaetft
fhadictlpeterkikkqtalvelvkhkphatndqlktvvgeftalldkccsaedkeacf
avegpklvesskatlg

SCOPe Domain Coordinates for d4f5va3:

Click to download the PDB-style file with coordinates for d4f5va3.
(The format of our PDB-style files is described here.)

Timeline for d4f5va3: