| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
| Protein automated matches [254493] (6 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (3 PDB entries) |
| Domain d4f5va2: 4f5v A:197-388 [251898] automated match to d4l8ua2 complexed with act, pg4, pge |
PDB Entry: 4f5v (more details), 2.27 Å
SCOPe Domain Sequences for d4f5va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5va2 a.126.1.0 (A:197-388) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rlrcasiqkfgdraykawalvrlsqrfpkadftdiskivtdltkvhkecchgdllecadd
radlakymcehqetisshlkeccdkpilekahciyglhndetpaglpavaeefvedkdvc
knyeeakdlflgkflyeysrrhpdysvvlllrlgkayeatlkkccatddphacyakvlde
fqplvdepknlv
Timeline for d4f5va2: