SCOPe 2.05: Domain d4f5va1: 4f5v A:1-196

Lineage for d4f5va1 (4f5v A:1-196)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (5 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (3 PDB entries)

8. Domain d4f5va1: 4f5v A:1-196 [251897]
   automated match to d3jrya1
   complexed with act, pg4, pge

Details for d4f5va1

PDB Entry: 4f5v, 2.27 Å

PDB Description: Crystal Structure of Leporine Serum Albumin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4f5va1:

Sequence; same for both SEQRES and ATOM records:

>d4f5va1 a.126.1.0 (A:1-196) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eahkseiahrfndvgeehfiglvlitfsqylqkcpyeehaklvkevtdlakacvadesaa
ncdkslhdifgdkicalpslrdtygdvadccekkepernecflhhkddkpdlppfarpea
dvlckafhddekaffghylyevarrhpyfyapellyyaqkykailtecceaadkgacltp
kldalkekalisaaqe

Timeline for d4f5va1:

• d4f5va1 first appeared in SCOPe 2.04
  
• d4f5va1 appears in SCOPe 2.06
  
• d4f5va1 appears in the current release, SCOPe 2.08