Lineage for d4f5ua3 (4f5u A:388-583)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730752Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries)
  8. 2730755Domain d4f5ua3: 4f5u A:388-583 [251896]
    automated match to d4emxa3
    complexed with lmr, mli, sin

Details for d4f5ua3

PDB Entry: 4f5u (more details), 2.04 Å

PDB Description: Crystal structure of Equine Serum Albumin at 2.04 resolution
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4f5ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5ua3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgredkeacf
aeegpklvassqlala

SCOPe Domain Coordinates for d4f5ua3:

Click to download the PDB-style file with coordinates for d4f5ua3.
(The format of our PDB-style files is described here.)

Timeline for d4f5ua3: