![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (6 species) not a true protein |
![]() | Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries) |
![]() | Domain d4f5ua3: 4f5u A:388-583 [251896] automated match to d4emxa3 complexed with lmr, mli, sin |
PDB Entry: 4f5u (more details), 2.04 Å
SCOPe Domain Sequences for d4f5ua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5ua3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]} kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgredkeacf aeegpklvassqlala
Timeline for d4f5ua3: