Lineage for d4f5sb3 (4f5s B:388-583)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1503613Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1503614Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1503945Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 1503946Protein automated matches [254493] (5 species)
    not a true protein
  7. 1503947Species Cow (Bos taurus) [TaxId:9913] [256128] (4 PDB entries)
  8. 1503953Domain d4f5sb3: 4f5s B:388-583 [251890]
    automated match to d4emxa3
    complexed with pge

Details for d4f5sb3

PDB Entry: 4f5s (more details), 2.47 Å

PDB Description: crystal structure of bovine serum albumin
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4f5sb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5sb3 a.126.1.0 (B:388-583) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kqncdqfeklgeygfqnalivrytrkvpqvstptlvevsrslgkvgtrcctkpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsaltpdetyvpkafdeklft
fhadictlpdtekqikkqtalvellkhkpkateeqlktvmenfvafvdkccaaddkeacf
avegpklvvstqtala

SCOPe Domain Coordinates for d4f5sb3:

Click to download the PDB-style file with coordinates for d4f5sb3.
(The format of our PDB-style files is described here.)

Timeline for d4f5sb3: