| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
| Protein automated matches [254493] (6 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries) |
| Domain d4f5sb1: 4f5s B:1-195 [251888] automated match to d3jrya1 complexed with pge |
PDB Entry: 4f5s (more details), 2.47 Å
SCOPe Domain Sequences for d4f5sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f5sb1 a.126.1.0 (B:1-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dthkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadesha
gcekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpn
tlcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpk
ietmrekvltssarq
Timeline for d4f5sb1: