| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4f2md1: 4f2m D:1-107 [251877] Other proteins in same PDB: d4f2ma1, d4f2ma2, d4f2mb2, d4f2mc1, d4f2mc2, d4f2md2 automated match to d1a5fl1 complexed with acy, nag |
PDB Entry: 4f2m (more details), 3 Å
SCOPe Domain Sequences for d4f2md1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f2md1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspailsvspgervslscrasqsigtsihwyqqrtngsprplikyasesisgips
rfsgsgsgtdftlninsvesediadyfcqqtdswpttfgagtklelk
Timeline for d4f2md1: