Lineage for d4f2md1 (4f2m D:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760933Domain d4f2md1: 4f2m D:1-107 [251877]
    Other proteins in same PDB: d4f2ma1, d4f2ma2, d4f2mb2, d4f2mc1, d4f2mc2, d4f2md2
    automated match to d1a5fl1
    complexed with acy, nag

Details for d4f2md1

PDB Entry: 4f2m (more details), 3 Å

PDB Description: crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
PDB Compounds: (D:) monoclonal antibody 1AF10, light chain

SCOPe Domain Sequences for d4f2md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f2md1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspailsvspgervslscrasqsigtsihwyqqrtngsprplikyasesisgips
rfsgsgsgtdftlninsvesediadyfcqqtdswpttfgagtklelk

SCOPe Domain Coordinates for d4f2md1:

Click to download the PDB-style file with coordinates for d4f2md1.
(The format of our PDB-style files is described here.)

Timeline for d4f2md1: