SCOPe 2.06: Domain d4f21h1: 4f21 H:1-222

Lineage for d4f21h1 (4f21 H:1-222)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [256250] (1 PDB entry)

8. Domain d4f21h1: 4f21 H:1-222 [251874]
   Other proteins in same PDB: d4f21a2, d4f21b2, d4f21c2, d4f21d2, d4f21e2, d4f21f2, d4f21g2, d4f21h2
   automated match to d1auoa_
   complexed with 0s1

Details for d4f21h1

PDB Entry: 4f21, 2.5 Å

PDB Description: crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis

PDB Compounds: (H:) Carboxylesterase/phospholipase family protein

SCOPe Domain Sequences for d4f21h1:

Sequence, based on SEQRES records:

>d4f21h1 c.69.1.0 (H:1-222) automated matches {Francisella tularensis [TaxId: 177416]}
mnyelmepakqarfcviwlhglgadghdfvdivnyfdvsldeirfifphadiipvtinmg
mqmrawydiksldanslnrvvdveginssiakvnklidsqvnqgiaseniilagfsqggi
iatytaitsqrklggimalstylpawdnfkgkitsinkglpilvchgtddqvlpevlghd
lsdklkvsgfaneykhyvgmqhsvcmeeikdisnfiaktfki

Sequence, based on observed residues (ATOM records):

>d4f21h1 c.69.1.0 (H:1-222) automated matches {Francisella tularensis [TaxId: 177416]}
mnyelmepakqarfcviwlhghdfvdivnyfdvsldeirfifphaipvtimrawydikvv
dveginssiakvnklidsqvnqgiaseniilagfsqggiiatytaitsqrklggimalst
ylpawdnfkgkitsinkglpilvchgtddqvlpevlghdlsdklkvsgfaneykhyvgmq
hsvcmeeikdisnfiaktfki

Timeline for d4f21h1:

• d4f21h1 first appeared in SCOPe 2.04, called d4f21h_
  
• d4f21h1 was called d4f21h_ in SCOPe 2.05
  
• d4f21h1 appears in SCOPe 2.07
  
• d4f21h1 appears in the current release, SCOPe 2.08