SCOP 1.65: Domain d1se4_1: 1se4 1-121

Lineage for d1se4_1 (1se4 1-121)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (13 PDB entries)

8. Domain d1se4_1: 1se4 1-121 [25187]
   Other proteins in same PDB: d1se4_2
   complexed with lat

Details for d1se4_1

PDB Entry: 1se4, 1.9 Å

PDB Description: staphylococcal enterotoxin b complexed with lactose

SCOP Domain Sequences for d1se4_1:

Sequence; same for both SEQRES and ATOM records:

>d1se4_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

Timeline for d1se4_1:

• d1se4_1 first appeared (with stable ids) in SCOP 1.55
  
• d1se4_1 appears in SCOP 1.63
  
• d1se4_1 appears in SCOP 1.67
  
• d1se4_1 appears in the current release, SCOPe 2.08, called d1se4a1