Lineage for d4ezmk_ (4ezm K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001458Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 3001459Species Human (Homo sapiens) [TaxId:9606] [143958] (14 PDB entries)
    Uniprot P06734 156-298
  8. 3001499Domain d4ezmk_: 4ezm K: [251861]
    Other proteins in same PDB: d4ezma1, d4ezma2, d4ezmb1, d4ezmb2, d4ezmc1, d4ezmc2, d4ezmd1, d4ezmd2, d4ezme1, d4ezme2, d4ezmf1, d4ezmf2
    automated match to d1t8ca1
    complexed with man

Details for d4ezmk_

PDB Entry: 4ezm (more details), 3.1 Å

PDB Description: crystal structure of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
PDB Compounds: (K:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4ezmk_:

Sequence, based on SEQRES records: (download)

>d4ezmk_ d.169.1.1 (K:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrk
lgawvcdrlatctppa

Sequence, based on observed residues (ATOM records): (download)

>d4ezmk_ d.169.1.1 (K:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqdcvmmrgsgrwndafcdrklg
awvcdrlatctppa

SCOPe Domain Coordinates for d4ezmk_:

Click to download the PDB-style file with coordinates for d4ezmk_.
(The format of our PDB-style files is described here.)

Timeline for d4ezmk_: