Lineage for d1d5zc1 (1d5z C:2-121)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 228958Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 228959Species Staphylococcus aureus [TaxId:1280] [50227] (13 PDB entries)
  8. 228962Domain d1d5zc1: 1d5z C:2-121 [25186]
    Other proteins in same PDB: d1d5za1, d1d5za2, d1d5zb1, d1d5zb2, d1d5zc2
    complexed with ace, oda

Details for d1d5zc1

PDB Entry: 1d5z (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb

SCOP Domain Sequences for d1d5zc1:

Sequence, based on SEQRES records: (download)

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d1d5zc1 b.40.2.2 (C:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskkkrktcmyggvteh

SCOP Domain Coordinates for d1d5zc1:

Click to download the PDB-style file with coordinates for d1d5zc1.
(The format of our PDB-style files is described here.)

Timeline for d1d5zc1: