SCOPe 2.05: Domain d4ezme1: 4ezm E:335-436

Lineage for d4ezme1 (4ezm E:335-436)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4ezme1: 4ezm E:335-436 [251853]
   Other proteins in same PDB: d4ezmg_, d4ezmh_, d4ezmi_, d4ezmj_, d4ezmk_, d4ezml_
   automated match to d3zo0a1
   complexed with man

Details for d4ezme1

PDB Entry: 4ezm, 3.1 Å

PDB Description: crystal structure of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23

PDB Compounds: (E:) ig epsilon chain c region

SCOPe Domain Sequences for d4ezme1:

Sequence, based on SEQRES records:

>d4ezme1 b.1.1.0 (E:335-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrn
gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttkt

Sequence, based on observed residues (ATOM records):

>d4ezme1 b.1.1.0 (E:335-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsaylsrpspfdlfirksptitclvvdlapsqltwsrasgkpvqhstrkeekqrngtlt
vtstlpvgtrdwiegetyqcphlprarsttkt

Timeline for d4ezme1:

• d4ezme1 first appeared in SCOPe 2.04
  
• d4ezme1 appears in SCOPe 2.06
  
• d4ezme1 appears in the current release, SCOPe 2.08