Lineage for d4ezmb1 (4ezm B:336-436)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758496Domain d4ezmb1: 4ezm B:336-436 [251847]
    Other proteins in same PDB: d4ezmg_, d4ezmh_, d4ezmi_, d4ezmj_, d4ezmk_, d4ezml_
    automated match to d3zo0a1
    complexed with man

Details for d4ezmb1

PDB Entry: 4ezm (more details), 3.1 Å

PDB Description: crystal structure of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
PDB Compounds: (B:) ig epsilon chain c region

SCOPe Domain Sequences for d4ezmb1:

Sequence, based on SEQRES records: (download)

>d4ezmb1 b.1.1.0 (B:336-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrng
tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttkt

Sequence, based on observed residues (ATOM records): (download)

>d4ezmb1 b.1.1.0 (B:336-436) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsaylsrpspfdlfirksptitclvvdpskgtvqltwsrasgkpvqhstrkeekqrngtl
tvtstlpvgtrdwiegetyqcrvthphlpralmrsttkt

SCOPe Domain Coordinates for d4ezmb1:

Click to download the PDB-style file with coordinates for d4ezmb1.
(The format of our PDB-style files is described here.)

Timeline for d4ezmb1: