SCOPe 2.08: Domain d4ezma2: 4ezm A:437-545

Lineage for d4ezma2 (4ezm A:437-545)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4ezma2: 4ezm A:437-545 [251846]
   Other proteins in same PDB: d4ezmg_, d4ezmh_, d4ezmi_, d4ezmj_, d4ezmk_, d4ezml_
   automated match to d3zo0a2
   complexed with man

Details for d4ezma2

PDB Entry: 4ezm, 3.1 Å

PDB Description: crystal structure of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23

PDB Compounds: (A:) ig epsilon chain c region

SCOPe Domain Sequences for d4ezma2:

Sequence; same for both SEQRES and ATOM records:

>d4ezma2 b.1.1.0 (A:437-545) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgpraapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqpr
ktkgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

Timeline for d4ezma2:

• d4ezma2 first appeared in SCOPe 2.04
  
• d4ezma2 appears in SCOPe 2.07