Lineage for d4ezla4 (4ezl A:726-1093)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218054Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 2218055Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2218056Species Human (Homo sapiens) [TaxId:9606] [56174] (65 PDB entries)
  8. 2218091Domain d4ezla4: 4ezl A:726-1093 [251844]
    Other proteins in same PDB: d4ezla1, d4ezla2, d4ezla3, d4ezla5
    automated match to d1e7ua4
    complexed with 0se

Details for d4ezla4

PDB Entry: 4ezl (more details), 2.94 Å

PDB Description: Potent and Selective Inhibitors of PI3K-delta: Obtaining Isoform Selectivity from the Affinity Pocket and Tryptophan Shelf
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4ezla4:

Sequence, based on SEQRES records: (download)

>d4ezla4 d.144.1.4 (A:726-1093) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekctvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlvlg

Sequence, based on observed residues (ATOM records): (download)

>d4ezla4 d.144.1.4 (A:726-1093) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsadvssqvisqlkqklenlqnsqlpesfrvpyd
pglkagalaiekctvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqil
rimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevln
hwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfger
vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlg

SCOPe Domain Coordinates for d4ezla4:

Click to download the PDB-style file with coordinates for d4ezla4.
(The format of our PDB-style files is described here.)

Timeline for d4ezla4: