SCOPe 2.05: Domain d4ezla3: 4ezl A:525-725

Lineage for d4ezla3 (4ezl A:525-725)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (58 PDB entries)

8. Domain d4ezla3: 4ezl A:525-725 [251843]
   Other proteins in same PDB: d4ezla1, d4ezla2, d4ezla4
   automated match to d1e7ua1
   complexed with 0se

Details for d4ezla3

PDB Entry: 4ezl, 2.94 Å

PDB Description: Potent and Selective Inhibitors of PI3K-delta: Obtaining Isoform Selectivity from the Affinity Pocket and Tryptophan Shelf

PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4ezla3:

Sequence, based on SEQRES records:

>d4ezla3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d4ezla3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgq
qeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
lrgcg

Timeline for d4ezla3:

• d4ezla3 first appeared in SCOPe 2.04
  
• d4ezla3 appears in SCOPe 2.06
  
• d4ezla3 appears in the current release, SCOPe 2.08