Lineage for d4ezla1 (4ezl A:144-320)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159292Family d.15.1.5: Ras-binding domain, RBD [54263] (14 protein domains)
    contains Pfam PF00788 and Pfam PF02196
  6. 2159312Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2159313Species Human (Homo sapiens) [TaxId:9606] [54276] (65 PDB entries)
  8. 2159347Domain d4ezla1: 4ezl A:144-320 [251841]
    Other proteins in same PDB: d4ezla2, d4ezla3, d4ezla4, d4ezla5
    automated match to d1e7ua3
    complexed with 0se

Details for d4ezla1

PDB Entry: 4ezl (more details), 2.94 Å

PDB Description: Potent and Selective Inhibitors of PI3K-delta: Obtaining Isoform Selectivity from the Affinity Pocket and Tryptophan Shelf
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4ezla1:

Sequence, based on SEQRES records: (download)

>d4ezla1 d.15.1.5 (A:144-320) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrk

Sequence, based on observed residues (ATOM records): (download)

>d4ezla1 d.15.1.5 (A:144-320) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkeqdfvlrvcgrd
eylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrk

SCOPe Domain Coordinates for d4ezla1:

Click to download the PDB-style file with coordinates for d4ezla1.
(The format of our PDB-style files is described here.)

Timeline for d4ezla1: