![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries) |
![]() | Domain d4ez6d1: 4ez6 D:297-468 [251827] Other proteins in same PDB: d4ez6a2, d4ez6d2 automated match to d3pv8d1 protein/DNA complex; complexed with dg3, mpd, so4 |
PDB Entry: 4ez6 (more details), 1.64 Å
SCOPe Domain Sequences for d4ez6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ez6d1 c.55.3.0 (D:297-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]} akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d4ez6d1: