SCOPe 2.07: Domain d4ez6d1: 4ez6 D:297-468

Lineage for d4ez6d1 (4ez6 D:297-468)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (36 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries)

8. Domain d4ez6d1: 4ez6 D:297-468 [251827]
   Other proteins in same PDB: d4ez6a2, d4ez6d2
   automated match to d3pv8d1
   protein/DNA complex; complexed with dg3, mpd, so4

Details for d4ez6d1

PDB Entry: 4ez6, 1.64 Å

PDB Description: Bacillus DNA Polymerase I Large Fragment Complex 1

PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d4ez6d1:

Sequence; same for both SEQRES and ATOM records:

>d4ez6d1 c.55.3.0 (D:297-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4ez6d1:

• d4ez6d1 first appeared in SCOPe 2.04
  
• d4ez6d1 appears in SCOPe 2.06