SCOPe 2.04: Domain d4eyba_: 4eyb A:

Lineage for d4eyba_ (4eyb A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (28 PDB entries)

8. Domain d4eyba_: 4eyb A: [251819]
   automated match to d4ey2a_
   complexed with 0wo, zn

Details for d4eyba_

PDB Entry: 4eyb, 1.16 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed oxacillin

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4eyba_:

Sequence; same for both SEQRES and ATOM records:

>d4eyba_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

Timeline for d4eyba_:

• d4eyba_ is new in SCOPe 2.04-stable
  
• d4eyba_ appears in SCOPe 2.05
  
• d4eyba_ appears in the current release, SCOPe 2.08