SCOPe 2.06: Domain d4exsa1: 4exs A:34-270

Lineage for d4exsa1 (4exs A:34-270)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (37 PDB entries)

8. Domain d4exsa1: 4exs A:34-270 [251815]
   Other proteins in same PDB: d4exsa2, d4exsb2
   automated match to d4ey2a_
   complexed with x8z, zn

Details for d4exsa1

PDB Entry: 4exs, 2.4 Å

PDB Description: Crystal structure of NDM-1 bound to L-captopril

PDB Compounds: (A:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4exsa1:

Sequence; same for both SEQRES and ATOM records:

>d4exsa1 d.157.1.0 (A:34-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtaw
tddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeg
mvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikds
kakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4exsa1:

• d4exsa1 first appeared in SCOPe 2.04, called d4exsa_
  
• d4exsa1 was called d4exsa_ in SCOPe 2.05
  
• d4exsa1 appears in SCOPe 2.07
  
• d4exsa1 appears in the current release, SCOPe 2.08