Lineage for d4evib1 (4evi B:1-112)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 1983834Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)
  8. 1983840Domain d4evib1: 4evi B:1-112 [251813]
    Other proteins in same PDB: d4evia2, d4evib2, d4evib3
    automated match to d4e70a1
    complexed with c9m, gol, n7i, sah

Details for d4evib1

PDB Entry: 4evi (more details), 2.02 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum in Complex with Coniferyl Alcohol 9-Methyl Ether and S -Adenosyl-L-Homocysteine
PDB Compounds: (B:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4evib1:

Sequence, based on SEQRES records: (download)

>d4evib1 a.4.5.0 (B:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records): (download)

>d4evib1 a.4.5.0 (B:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkplpsywlaplsrlllkqnp

SCOPe Domain Coordinates for d4evib1:

Click to download the PDB-style file with coordinates for d4evib1.
(The format of our PDB-style files is described here.)

Timeline for d4evib1: