![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Linum nodiflorum [TaxId:407264] [234382] (3 PDB entries) |
![]() | Domain d4evia2: 4evi A:113-368 [251812] Other proteins in same PDB: d4evia1, d4evib1, d4evib3 automated match to d4e70a2 complexed with c9m, gol, n7i, sah |
PDB Entry: 4evi (more details), 2.02 Å
SCOPe Domain Sequences for d4evia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4evia2 c.66.1.0 (A:113-368) automated matches {Linum nodiflorum [TaxId: 407264]} ynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkkvyevcsedanfs qlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdl phvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkn gvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdy kitpvgglrvlievyp
Timeline for d4evia2: