Lineage for d4evia2 (4evi A:113-368)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894805Species Linum nodiflorum [TaxId:407264] [234382] (3 PDB entries)
  8. 2894810Domain d4evia2: 4evi A:113-368 [251812]
    Other proteins in same PDB: d4evia1, d4evib1, d4evib3
    automated match to d4e70a2
    complexed with c9m, gol, n7i, sah

Details for d4evia2

PDB Entry: 4evi (more details), 2.02 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum in Complex with Coniferyl Alcohol 9-Methyl Ether and S -Adenosyl-L-Homocysteine
PDB Compounds: (A:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4evia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4evia2 c.66.1.0 (A:113-368) automated matches {Linum nodiflorum [TaxId: 407264]}
ynarsltfcsvhehlvdpwrqmsawlrtgkedgkdtpnafafahegkkvyevcsedanfs
qlfsegmagdswlfsralvskcrdafeglsslvdvgggtgntskviaetfpnihctvfdl
phvvsgpkqthpnldyesgnmftdeiphadavlfkwvlcdwpdepvlkmlkqckkaltkn
gvkgklmiadhvldhescndsnsmgtslildmlfmsflegslrtekqwaklfaeagfkdy
kitpvgglrvlievyp

SCOPe Domain Coordinates for d4evia2:

Click to download the PDB-style file with coordinates for d4evia2.
(The format of our PDB-style files is described here.)

Timeline for d4evia2: