Lineage for d4etia_ (4eti A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454323Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2454324Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2454393Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2454394Protein automated matches [190574] (17 species)
    not a true protein
  7. 2454395Species Bacillus subtilis [TaxId:1423] [193436] (3 PDB entries)
  8. 2454399Domain d4etia_: 4eti A: [251805]
    automated match to d2wjaa_
    complexed with fmt

Details for d4etia_

PDB Entry: 4eti (more details), 1.8 Å

PDB Description: Crystal Structure of YwlE from Bacillus subtilis
PDB Compounds: (A:) Low molecular weight protein-tyrosine-phosphatase ywlE

SCOPe Domain Sequences for d4etia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4etia_ c.44.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mdiifvctgntcrspmaealfksiaereglnvnvrsagvfaspngkatphavealfekhi
alnhvssplteelmesadlvlamthqhkqiiasqfgryrdkvftlkeyvtgshgdvldpf
ggsidiykqtrdeleellrqlakqlkkdrr

SCOPe Domain Coordinates for d4etia_:

Click to download the PDB-style file with coordinates for d4etia_.
(The format of our PDB-style files is described here.)

Timeline for d4etia_: