Lineage for d4er7a_ (4er7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130146Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 protein domains)
  6. 2130154Protein automated matches [191247] (1 species)
    not a true protein
  7. 2130155Species Human (Homo sapiens) [TaxId:9606] [189737] (27 PDB entries)
  8. 2130159Domain d4er7a_: 4er7 A: [251802]
    automated match to d1nw3a_
    complexed with aw3, gol

Details for d4er7a_

PDB Entry: 4er7 (more details), 2.2 Å

PDB Description: crystal structure of human dot1l in complex with inhibitor sgc0947
PDB Compounds: (A:) Histone-lysine N-methyltransferase, H3 lysine-79 specific

SCOPe Domain Sequences for d4er7a_:

Sequence, based on SEQRES records: (download)

>d4er7a_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidy
dtksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpe
klnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhy
gvekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnf
afgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsv
swtgkpvsyylhtidrtilenyfsslknpklreeqeaar

Sequence, based on observed residues (ATOM records): (download)

>d4er7a_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamidydtksf
esmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpeklnny
eetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhygvekadipakyae
tmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfafgpevdhqlker
fanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsvswtgkpvsyylht
idrtilenyfsslknpklreeqeaar

SCOPe Domain Coordinates for d4er7a_:

Click to download the PDB-style file with coordinates for d4er7a_.
(The format of our PDB-style files is described here.)

Timeline for d4er7a_: