Lineage for d4eqma_ (4eqm A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223663Species Staphylococcus aureus [TaxId:158879] [256249] (1 PDB entry)
  8. 2223664Domain d4eqma_: 4eqm A: [251792]
    automated match to d4jjra_
    complexed with anp, ben

Details for d4eqma_

PDB Entry: 4eqm (more details), 3 Å

PDB Description: structural analysis of staphylococcus aureus serine/threonine kinase pknb
PDB Compounds: (A:) Protein kinase

SCOPe Domain Sequences for d4eqma_:

Sequence, based on SEQRES records: (download)

>d4eqma_ d.144.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
ikhahdmrivhrdikpqnilidsnktlkifdfgiakalsetsltqtnhvlgtvqyfspeq
akgeatdectdiysigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqs
lsnvilratekdkanryktiqemkddlssvlhenranedvye

Sequence, based on observed residues (ATOM records): (download)

>d4eqma_ d.144.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
migkiinerykivdklggggmstvylaedtilnikvaikaifipprekeetlkrferevh
nssqlshqnivsmidvdeeddcyylvmeyiegptlseyieshgplsvdtainftnqildg
ikhahdmrivhrdikpqnilidsnktlkifdfgiakaltvqyfspeqakgeatdectdiy
sigivlyemlvgeppfngetavsiaikhiqdsvpnvttdvrkdipqslsnvilratekdk
anryktiqemkddlssvlhenranedvye

SCOPe Domain Coordinates for d4eqma_:

Click to download the PDB-style file with coordinates for d4eqma_.
(The format of our PDB-style files is described here.)

Timeline for d4eqma_: