Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188940] (5 PDB entries) |
Domain d4enza6: 4enz A:885-1040 [251788] automated match to d1kcwa6 complexed with ca, cu, gol, na, nag, o, oxy |
PDB Entry: 4enz (more details), 2.6 Å
SCOPe Domain Sequences for d4enza6:
Sequence, based on SEQRES records: (download)
>d4enza6 b.6.1.0 (A:885-1040) automated matches {Human (Homo sapiens) [TaxId: 9606]} ylkvfnprrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaing rmfgnlqgltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgty qtlemfprtpgiwllhchvtdhihagmettytvlqn
>d4enza6 b.6.1.0 (A:885-1040) automated matches {Human (Homo sapiens) [TaxId: 9606]} ynprrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfg nlqgltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtle mfprtpgiwllhchvtdhihagmettytvlqn
Timeline for d4enza6: