SCOPe 2.05: Domain d4enza4: 4enz A:554-705

Lineage for d4enza4 (4enz A:554-705)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (24 PDB entries)

8. Domain d4enza4: 4enz A:554-705 [251786]
   automated match to d1kcwa4
   complexed with ca, cu, gol, na, nag, o, oxy

Details for d4enza4

PDB Entry: 4enz, 2.6 Å

PDB Description: structure of human ceruloplasmin at 2.6 a resolution

PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d4enza4:

Sequence; same for both SEQRES and ATOM records:

>d4enza4 b.6.1.0 (A:554-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqp
gltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdte
gtfnveclttdhytggmkqkytvnqcrrqsed

Timeline for d4enza4:

• d4enza4 first appeared in SCOPe 2.04
  
• d4enza4 appears in SCOPe 2.06
  
• d4enza4 appears in the current release, SCOPe 2.08