Lineage for d4enza4 (4enz A:554-705)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772509Domain d4enza4: 4enz A:554-705 [251786]
    automated match to d1kcwa4
    complexed with ca, cu, gol, na, nag, o, oxy

Details for d4enza4

PDB Entry: 4enz (more details), 2.6 Å

PDB Description: structure of human ceruloplasmin at 2.6 a resolution
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d4enza4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4enza4 b.6.1.0 (A:554-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqp
gltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdte
gtfnveclttdhytggmkqkytvnqcrrqsed

SCOPe Domain Coordinates for d4enza4:

Click to download the PDB-style file with coordinates for d4enza4.
(The format of our PDB-style files is described here.)

Timeline for d4enza4: