Lineage for d4enza2 (4enz A:193-338)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2044679Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2044680Protein automated matches [190824] (23 species)
    not a true protein
  7. 2044869Species Human (Homo sapiens) [TaxId:9606] [188940] (24 PDB entries)
  8. 2044897Domain d4enza2: 4enz A:193-338 [251784]
    automated match to d1kcwa2
    complexed with ca, cu, gol, na, nag, o, oxy

Details for d4enza2

PDB Entry: 4enz (more details), 2.6 Å

PDB Description: structure of human ceruloplasmin at 2.6 a resolution
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d4enza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4enza2 b.6.1.0 (A:193-338) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqesnrmysvngytfgslp
glsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpatlfdaymvaqnp
gewmlscqnlnhlkaglqaffqvqec

SCOPe Domain Coordinates for d4enza2:

Click to download the PDB-style file with coordinates for d4enza2.
(The format of our PDB-style files is described here.)

Timeline for d4enza2: