Lineage for d4emsb1 (4ems B:0-112)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 1983834Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)
  8. 1983838Domain d4emsb1: 4ems B:0-112 [251777]
    Other proteins in same PDB: d4emsa2, d4emsb2, d4emsb3
    automated match to d4e70a1
    complexed with gol

Details for d4emsb1

PDB Entry: 4ems (more details), 1.75 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum
PDB Compounds: (B:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4emsb1:

Sequence, based on SEQRES records: (download)

>d4emsb1 a.4.5.0 (B:0-112) automated matches {Linum nodiflorum [TaxId: 407264]}
hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei
pqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records): (download)

>d4emsb1 a.4.5.0 (B:0-112) automated matches {Linum nodiflorum [TaxId: 407264]}
hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei
pqtkapflsrlmrmlvhlgyftqvitkpevlpsywlaplsrlllkqnp

SCOPe Domain Coordinates for d4emsb1:

Click to download the PDB-style file with coordinates for d4emsb1.
(The format of our PDB-style files is described here.)

Timeline for d4emsb1: