Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries) |
Domain d4emsb1: 4ems B:0-112 [251777] Other proteins in same PDB: d4emsa2, d4emsb2, d4emsb3 automated match to d4e70a1 complexed with gol |
PDB Entry: 4ems (more details), 1.75 Å
SCOPe Domain Sequences for d4emsb1:
Sequence, based on SEQRES records: (download)
>d4emsb1 a.4.5.0 (B:0-112) automated matches {Linum nodiflorum [TaxId: 407264]} hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei pqtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp
>d4emsb1 a.4.5.0 (B:0-112) automated matches {Linum nodiflorum [TaxId: 407264]} hmdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaalei pqtkapflsrlmrmlvhlgyftqvitkpevlpsywlaplsrlllkqnp
Timeline for d4emsb1: