Lineage for d4emsa1 (4ems A:1-112)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694863Species Linum nodiflorum [TaxId:407264] [234362] (3 PDB entries)
  8. 2694866Domain d4emsa1: 4ems A:1-112 [251775]
    Other proteins in same PDB: d4emsa2, d4emsb2, d4emsb3
    automated match to d4e70a1
    complexed with gol

Details for d4emsa1

PDB Entry: 4ems (more details), 1.75 Å

PDB Description: Crystal Structure Analysis of Coniferyl Alcohol 9-O-Methyltransferase from Linum Nodiflorum
PDB Compounds: (A:) Coniferyl alcohol 9-O-methyltransferase

SCOPe Domain Sequences for d4emsa1:

Sequence, based on SEQRES records: (download)

>d4emsa1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkpedenddvlpsywlaplsrlllkqnp

Sequence, based on observed residues (ATOM records): (download)

>d4emsa1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}
mdaatavelldaqpqvwhhflgyinsmtlqcaleldiadvihrhghpiplnqlaaaleip
qtkapflsrlmrmlvhlgyftqvitkplpsywlaplsrlllkqnp

SCOPe Domain Coordinates for d4emsa1:

Click to download the PDB-style file with coordinates for d4emsa1.
(The format of our PDB-style files is described here.)

Timeline for d4emsa1: