Lineage for d4elda_ (4eld A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773839Family b.15.1.1: HSP20 [49765] (2 proteins)
  6. 2773840Protein Small heat shock protein [49766] (2 species)
  7. 2773841Species Methanococcus jannaschii [TaxId:2190] [49767] (3 PDB entries)
  8. 2773842Domain d4elda_: 4eld A: [251773]
    automated match to d4i88b_

Details for d4elda_

PDB Entry: 4eld (more details), 2.7 Å

PDB Description: Crystal Structure of an Activated Variant of Small Heat Shock Protein Hsp16.5
PDB Compounds: (A:) Small heat shock protein HSP16.5

SCOPe Domain Sequences for d4elda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elda_ b.15.1.1 (A:) Small heat shock protein {Methanococcus jannaschii [TaxId: 2190]}
vaagiqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmite
seriiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie

SCOPe Domain Coordinates for d4elda_:

Click to download the PDB-style file with coordinates for d4elda_.
(The format of our PDB-style files is described here.)

Timeline for d4elda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4eldb_