SCOPe 2.08: Domain d4ei5h2: 4ei5 H:116-237

Lineage for d4ei5h2 (4ei5 H:116-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4ei5h2: 4ei5 H:116-237 [251769]
   Other proteins in same PDB: d4ei5b_, d4ei5c2, d4ei5e1, d4ei5e3, d4ei5f_
   automated match to d3q5ya2
   complexed with cis, flc, nag

Details for d4ei5h2

PDB Entry: 4ei5, 3.1 Å

PDB Description: crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1

PDB Compounds: (H:) Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei5h2:

Sequence, based on SEQRES records:

>d4ei5h2 b.1.1.0 (H:116-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
sa

Sequence, based on observed residues (ATOM records):

>d4ei5h2 b.1.1.0 (H:116-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
pndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa

Timeline for d4ei5h2:

• d4ei5h2 first appeared in SCOPe 2.04
  
• d4ei5h2 appears in SCOPe 2.07