Lineage for d4ei5g1 (4ei5 G:2-114)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520979Domain d4ei5g1: 4ei5 G:2-114 [251767]
    Other proteins in same PDB: d4ei5b_, d4ei5c2, d4ei5e1, d4ei5f_
    automated match to d2pyfa1
    complexed with cis, flc, nag

Details for d4ei5g1

PDB Entry: 4ei5 (more details), 3.1 Å

PDB Description: crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
PDB Compounds: (G:) Valpha1 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei5g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei5g1 b.1.1.0 (G:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qkvqqspeslsvpeggmaslnctssdrnfqyfwwyrqhsgegpkalmsifsdgdkkegrf
tahlnkaslhvslhirdsqpsdsalyfcaaseqnnyaqgltfglgtrvsvfpy

SCOPe Domain Coordinates for d4ei5g1:

Click to download the PDB-style file with coordinates for d4ei5g1.
(The format of our PDB-style files is described here.)

Timeline for d4ei5g1: