Lineage for d4ei5e1 (4ei5 E:7-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544622Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2544673Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2544691Domain d4ei5e1: 4ei5 E:7-185 [251764]
    Other proteins in same PDB: d4ei5b_, d4ei5c1, d4ei5c2, d4ei5d1, d4ei5d2, d4ei5e2, d4ei5e3, d4ei5f_, d4ei5g1, d4ei5h1, d4ei5h2
    automated match to d4f7ca1
    complexed with cis, flc, nag

Details for d4ei5e1

PDB Entry: 4ei5 (more details), 3.1 Å

PDB Description: crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4ei5e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei5e1 d.19.1.1 (E:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d4ei5e1:

Click to download the PDB-style file with coordinates for d4ei5e1.
(The format of our PDB-style files is described here.)

Timeline for d4ei5e1: