![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d4ei5d1: 4ei5 D:2-115 [251762] Other proteins in same PDB: d4ei5b_, d4ei5c2, d4ei5e1, d4ei5e3, d4ei5f_ automated match to d3q5ya1 complexed with cis, flc, nag |
PDB Entry: 4ei5 (more details), 3.1 Å
SCOPe Domain Sequences for d4ei5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ei5d1 b.1.1.0 (D:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksklf kdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvle
Timeline for d4ei5d1: