Lineage for d4ei5d1 (4ei5 D:2-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760946Domain d4ei5d1: 4ei5 D:2-115 [251762]
    Other proteins in same PDB: d4ei5b_, d4ei5c2, d4ei5e1, d4ei5e3, d4ei5f_
    automated match to d3q5ya1
    complexed with cis, flc, nag

Details for d4ei5d1

PDB Entry: 4ei5 (more details), 3.1 Å

PDB Description: crystal structure of xv19 tcr in complex with cd1d-sulfatide c24:1
PDB Compounds: (D:) Vbeta16 XV19 Type II Natural Killer T cell receptor (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4ei5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei5d1 b.1.1.0 (D:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pkvlqipshqiidmgqmvtlncdpvsnhlyfywykqilgqqmeflvnfyngkvmeksklf
kdqfsverpdgsyftlkiqptaledsavyfcassfwgayaeqffgpgtrltvle

SCOPe Domain Coordinates for d4ei5d1:

Click to download the PDB-style file with coordinates for d4ei5d1.
(The format of our PDB-style files is described here.)

Timeline for d4ei5d1: