Lineage for d4ehpa2 (4ehp A:129-252)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700113Protein Vinculin [47224] (2 species)
  7. 2700127Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2700144Domain d4ehpa2: 4ehp A:129-252 [251758]
    automated match to d3s90b2
    complexed with act

Details for d4ehpa2

PDB Entry: 4ehp (more details), 2.66 Å

PDB Description: Crystal Structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382)
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d4ehpa2:

Sequence, based on SEQRES records: (download)

>d4ehpa2 a.24.9.1 (A:129-252) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qlts

Sequence, based on observed residues (ATOM records): (download)

>d4ehpa2 a.24.9.1 (A:129-252) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknskieealknrnftvekmsaeineiirvlqlt
s

SCOPe Domain Coordinates for d4ehpa2:

Click to download the PDB-style file with coordinates for d4ehpa2.
(The format of our PDB-style files is described here.)

Timeline for d4ehpa2: