SCOPe 2.05: Domain d4ehpa1: 4ehp A:2-128

Lineage for d4ehpa1 (4ehp A:2-128)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (10 PDB entries)
   Uniprot P18206 1-257

8. Domain d4ehpa1: 4ehp A:2-128 [251757]
   automated match to d3s90b1
   complexed with act

Details for d4ehpa1

PDB Entry: 4ehp, 2.66 Å

PDB Description: Crystal Structure of human vinculin head domain (residues 1-252) in complex with alpha-catenin (residues 277-382)

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d4ehpa1:

Sequence; same for both SEQRES and ATOM records:

>d4ehpa1 a.24.9.1 (A:2-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
pvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgket
vqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsd
llltfde

Timeline for d4ehpa1:

• d4ehpa1 first appeared in SCOPe 2.04
  
• d4ehpa1 appears in SCOPe 2.06
  
• d4ehpa1 appears in the current release, SCOPe 2.08