Lineage for d4egpb_ (4egp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005837Species Rhodopseudomonas palustris [TaxId:316058] [193594] (6 PDB entries)
  8. 2005859Domain d4egpb_: 4egp B: [251752]
    automated match to d4egmb_
    complexed with cl, fiv, gol, hem, so4

Details for d4egpb_

PDB Entry: 4egp (more details), 3 Å

PDB Description: The X-ray crystal structure of CYP199A4 in complex with 2-naphthoic acid
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d4egpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egpb_ a.104.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
rkvaaididgpvkrrfnntlrgleslpvkltpa

SCOPe Domain Coordinates for d4egpb_:

Click to download the PDB-style file with coordinates for d4egpb_.
(The format of our PDB-style files is described here.)

Timeline for d4egpb_: