Lineage for d4egbb1 (4egb B:1-321)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094364Species Bacillus anthracis [TaxId:198094] [189998] (4 PDB entries)
  8. 2094372Domain d4egbb1: 4egb B:1-321 [251744]
    Other proteins in same PDB: d4egba2, d4egbb2, d4egbc2, d4egbd2, d4egbe2, d4egbf2, d4egbg2, d4egbh2
    automated match to d2hunb_
    complexed with nad, ni, so4, suc

Details for d4egbb1

PDB Entry: 4egb (more details), 3 Å

PDB Description: 3.0 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. ames in complex with nad
PDB Compounds: (B:) dtdp-glucose 4,6-dehydratase

SCOPe Domain Sequences for d4egbb1:

Sequence, based on SEQRES records: (download)

>d4egbb1 c.2.1.0 (B:1-321) automated matches {Bacillus anthracis [TaxId: 198094]}
mnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkgei
qngellehvikerdvqvivnfaaeshvdrsienpipfydtnvigtvtllelvkkyphikl
vqvstdevygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnn
ygpyqypekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyn
iggnnektnvevveqiitllgktkkdieyvtdrlghdrryainaekmknefdwepkytfe
qglqetvqwyekneewwkplk

Sequence, based on observed residues (ATOM records): (download)

>d4egbb1 c.2.1.0 (B:1-321) automated matches {Bacillus anthracis [TaxId: 198094]}
mnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkgei
qngellehvikerdvqvivnfaaeipfydtnvigtvtllelvkkyphiklvqvstdevyg
slgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqypekl
iplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnektnv
evveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwyekne
ewwkplk

SCOPe Domain Coordinates for d4egbb1:

Click to download the PDB-style file with coordinates for d4egbb1.
(The format of our PDB-style files is described here.)

Timeline for d4egbb1: